Skip to content

Repository files navigation

ProteinTensor Introduction

ProteinTensor is an AI-native biomolecular storage format designed to eliminate the preprocessing bottleneck in modern structural biology machine learning pipelines. It converts a protein, nucleic-acid, or protein-ligand structure - or a raw sequence - once into a .ptt file, then loads every tensor a model needs (backbone, bonds, MSA, embeddings, dense/sparse pair features, ligand pockets) with zero parsing.


The Problem

Every time a researcher trains AlphaFold, Boltz, RoseTTAFold, OpenFold, or any structure-prediction model, the same work happens before a single GPU operation runs:

for each protein in dataset:
    parse mmCIF / PDB file          (30 – 350 ms per structure)
    extract sequence tokens
    build atom coordinate arrays
    construct backbone geometry
    compute covalent bond graph
    load or regenerate MSA           (2 – 480 min with JackHMMER)
    run ESM2 / ESM3 inference        (seconds per protein on GPU)
    compute distance matrices
    ...

    -> finally: model.forward(features)

For a 100,000-structure training run this preprocessing costs thousands of CPU-hours per epoch - most of it producing identical results every time. The mmCIF file has not changed. The sequence has not changed. The physics has not changed. Yet every run recomputes everything from scratch.

ProteinTensor solves this by converting the PDB entry once into a .ptt file - a Zarr-backed, LZ4-compressed, memory-mappable store that holds every tensor a model needs - and then loading those tensors directly at training time with zero parsing.

once:   mmCIF  ->  ProteinTensor (.ptt)
always: .ptt   ->  model.forward()

Who This Is For

Structural biology researchers running AlphaFold 3, Boltz, or Chai-1 who spend hours waiting for MSA generation before every new experiment.

ML engineers at pharma and biotech companies iterating over large structure databases (PDB, AlphaFold Database, ESMAtlas) where I/O throughput is a training bottleneck measured in wall-clock days.

Academic labs with limited GPU budgets who cannot afford to waste compute cycles on re-parsing text files when those GPU-hours should go toward model training.

Software engineers building structural biology pipelines who want a single, well-defined intermediate format that works with PyTorch, JAX, and NumPy without writing custom loaders for every model.

ProteinTensor is to structural biology what Parquet is to analytics, what safetensors is to model weights, and what ONNX is to model exchange - a common, open, high- performance format that turns a recurring computational tax into a one-time cost.


Benchmark: Traditional Pipeline vs ProteinTensor

All timings are median over 30 rounds on a Windows workstation (RTX 5080, Python 3.11.9); mmCIF parsing and .ptt reads are CPU-bound, so these reflect CPU performance. Proteins span the full range from a 76-residue domain to a 3,525-residue CRISPR enzyme. Run python boltz_benchmark.py to reproduce.

Per-structure load times

Structure Method Res MSA seqs mmCIF parse ptt: full ptt: backbone ptt: bonds ptt: MSA ptt: dist mx
1UBQ - Ubiquitin X-ray 76 512 7.4 ms 3.2 ms 1.3 ms 0.8 ms 1.8 ms 0.8 ms
6LU7 - SARS-CoV-2 Mpro X-ray 312 1,024 28.7 ms 3.3 ms 1.3 ms 0.8 ms 5.2 ms 1.9 ms
4HHB - Hemoglobin X-ray 574 2,048 54.1 ms 3.3 ms 1.3 ms 0.8 ms 11.5 ms 3.6 ms
6M0J - ACE2 + RBD Cryo-EM 791 2,048 73.2 ms 3.3 ms 1.4 ms 0.8 ms 15.3 ms 6.9 ms
6VXX - Spike trimer Cryo-EM 2,916 8,192 283.9 ms 3.7 ms 1.4 ms 1.0 ms 213.7 ms 74.7 ms
6OHW - Cas12a Cryo-EM 3,525 8,192 346.5 ms 3.7 ms 1.3 ms 1.0 ms 243.9 ms 107.3 ms

Column definitions

  • ptt: full - read() - all atoms, backbone, bonds, metadata
  • ptt: backbone - read_backbone() - N/CA/C/O coordinates + sequence only
  • ptt: bonds - read_bonds() - covalent graph only
  • ptt: MSA - read_msa() - MSA tokens + profile (loaded from .ptt cache)
  • ptt: dist mx - read_pair_feature("distance_matrix") - Ca-Ca distance matrix

Speedup vs mmCIF baseline

Structure Res full backbone bonds MSA dist mx
1UBQ - Ubiquitin 76 2x 6x 10x 4x 9x
6LU7 - SARS-CoV-2 Mpro 312 9x 21x 38x 5x 15x
4HHB - Hemoglobin 574 17x 40x 70x 5x 15x
6M0J - ACE2 + RBD 791 22x 54x 92x 5x 11x
6VXX - Spike trimer 2,916 76x 201x 285x 1x* 4x
6OHW - Cas12a 3,525 95x 257x 343x 1x* 3x

*MSA speedup shown as 1x vs mmCIF parse because both are in the same time range for large proteins - the real MSA comparison is vs JackHMMER generation (see below).

Feature assembly: time to prepare all tensors for model.forward()

Traditional = mmCIF parse + A3M MSA parse + distance-matrix compute. ProteinTensor = read the structure, MSA, distance matrix, and ESM2 embedding from a single pre-cached .ptt. Reproduce with python benchmarks/assembly_benchmark.py (MSA depth and embedding shape are realistic; numeric content is synthetic, so timing reflects tensor dimensions, not values).

Structure Res MSA depth Traditional ProteinTensor Speedup
1UBQ - Ubiquitin 76 512 14.1 ms 7.1 ms 2.0x
6LU7 - SARS-CoV-2 Mpro 312 1,024 48.7 ms 13.6 ms 3.6x
4HHB - Hemoglobin 574 2,048 118.0 ms 22.7 ms 5.2x
6M0J - ACE2 + RBD 791 2,048 196.4 ms 38.3 ms 5.1x
6VXX - Spike trimer 2,916 8,192 1,395 ms 309 ms 4.5x
6OHW - Cas12a 3,525 8,192 1,462 ms 381 ms 3.8x

Average speedup across all six structures: 4x for full feature assembly (measured on a Windows CPU box - see benchmarks/ASSEMBLY_RESULTS.md).

On an earlier 34x figure: prior versions reported ~34x here. That number was measured against ProteinTensor's original scalar A3M parser, which dominated the traditional side (~11 s to parse an 8,192-deep MSA). Vectorizing that parser in v0.2.0 cut the traditional baseline ~8x, so the fair feature-assembly speedup is now ~4x. The .ptt read side was unchanged - only the baseline got faster.

Drug target benchmark

Same methodology across six high-value drug targets spanning KRAS oncology, HIV antivirals, PD-L1 immunotherapy, p53, cardiovascular (PCSK9), and a full IgG1 antibody. Numbers are consistent with the structural biology benchmark above.

Target Res mmCIF parse ptt: full ptt: backbone ptt: bonds ptt: MSA ptt: dist mx
6OIM - KRAS G12C + Sotorasib 167 17.1 ms 3.4 ms 1.3 ms 0.8 ms 3.0 ms 1.3 ms
3HTB - HIV-1 protease 163 16.5 ms 3.3 ms 1.4 ms 0.8 ms 2.8 ms 1.3 ms
5WT9 - PD-L1 checkpoint 533 54.8 ms 3.8 ms 1.4 ms 0.8 ms 11.9 ms 3.8 ms
1TUP - p53 tumor suppressor 585 57.4 ms 3.4 ms 1.4 ms 0.8 ms 13.0 ms 4.0 ms
2P4E - PCSK9 586 55.4 ms 3.4 ms 1.4 ms 0.8 ms 12.8 ms 4.1 ms
1IGT - IgG1 antibody 1,316 127.3 ms 3.5 ms 1.4 ms 0.8 ms 47.1 ms 17.9 ms
Target Res full backbone bonds MSA dist mx
6OIM - KRAS G12C + Sotorasib 167 5x 13x 22x 6x 13x
3HTB - HIV-1 protease 163 5x 12x 21x 6x 13x
5WT9 - PD-L1 checkpoint 533 15x 40x 69x 5x 14x
1TUP - p53 tumor suppressor 585 17x 42x 71x 4x 14x
2P4E - PCSK9 586 16x 41x 70x 4x 14x
1IGT - IgG1 antibody 1,316 37x 92x 156x 3x 7x

DataLoader throughput (real model, end-to-end)

The honest test - not a microbenchmark: a real PyTorch DataLoader feeding a small transformer (real forward + backward) on an RTX 5080, comparing traditional (parse mmCIF + A3M + compute distances per item) vs .ptt (zero-parse). GPU idle = fraction of wall-clock the GPU waits for data. Reproduce with python benchmarks/model_harness.py.

Model step workers traditional /s ptt /s throughput GPU idle (trad -> ptt)
5.4 ms 0 23.6 111.8 4.7x 96% -> 83%
5.4 ms 4 78.9 263.1 3.4x 87% -> 58%
21.1 ms 4 68.3 111.3 1.6x 56% -> 25%

.ptt wins most when the model step is cheap (data-bound); the throughput gap narrows as the model deepens, but the GPU-idle gap persists and num_workers>0 speeds up both without erasing it. Honest scope: a small model on one GPU - production models (AlphaFold/Boltz) have far heavier steps, where the throughput speedup converges toward 1x and the durable value is reclaimed GPU-idle time. See benchmarks/MODEL_HARNESS_RESULTS.md.

Scale projection: 100,000 structures, one training epoch

These are projections, extrapolated from the measured per-structure timings above - not end-to-end measurements at 100k scale.

Operation Traditional pipeline ProteinTensor Speedup
Structure load (parse mmCIF each epoch) 3.8 hours 6 min 37x
Backbone-only load (template search) 3.8 hours 2 min 95x
Full feature assembly (seq + MSA + pairs + emb) 16 hours 3.9 hours 4x
MSA generation (JackHMMER, 32-core CPU, once) 4,000 hours 2.7 hours 1,477x

MSA generation assumes 2.4 min/protein on a 32-core server (PDB90 database, standard AlphaFold settings). ProteinTensor generates MSAs once and loads from the .ptt cache on every subsequent run. The 4,000-hour figure is the real cost AlphaFold2 and Boltz users pay to build training datasets from scratch.

Measured vs projected - read this. The 1,477x above is MSA generation (building the alignment once with JackHMMER) and is a literature-based projection, not something benchmarked here. What is measured on hardware is the recurring per-epoch MSA load - reading a cached MSA from .ptt vs re-parsing A3M text each epoch (against a vectorized A3M parser baseline): 3.4x-5.9x, growing with MSA depth. See benchmarks/MSA_RESULTS.md. These are different quantities; do not read the 1,477x as a measured load speedup.

Disk tradeoff

A full-featured .ptt (8,192-sequence MSA + distance matrix + ESM2-650M embedding at float16) averages 23x larger than the source mmCIF across the six benchmark structures. The tradeoff is deliberate: pay disk space once to avoid paying GPU-hours and CPU-hours on every training run. A structure-only .ptt with no cached features is smaller than the source mmCIF. The dominant O(N^2) cost - dense pair features - can be stored as a sparse radius graph instead (compute_and_store_distances_sparse), cutting the distance matrix 2x-76x on disk with no loss inside the cutoff (see benchmarks/SPARSE_PAIRS_RESULTS.md).


Install

pip install -e ".[dev]"           # core + dev tools
pip install -e ".[cloud]"         # adds fsspec, s3fs, gcsfs for remote reads
pip install -e ".[dev,cloud]"     # everything

Requires Python >= 3.9, gemmi, zarr, numpy, click, rich.


Quick Start

Convert a structure

proteintensor convert 1abc.cif 1abc.ptt
proteintensor info 1abc.ptt

Convert a sequence (no structure required)

For sequence-driven predictors like AlphaFold and Boltz, the primary input is a sequence, not a structure. ProteinTensor can build a sequence-only .ptt (no coordinates) directly from a raw string or a FASTA file:

proteintensor convert-seq MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDG ubq.ptt
proteintensor convert-seq complex.fasta complex.ptt   # multi-record FASTA -> multi-chain
import proteintensor as pt

data = pt.from_sequence("MQIFVKTLTGK...", pdb_id="UBQ", chain_id="A")
data.has_structure        # False - sequence-only entry
data.sequence_tokens      # (N_res,)  int32

pt.write(data, "ubq.ptt")

# FASTA: a single record -> one chain; multiple records -> multi-chain complex
data = pt.from_fasta("complex.fasta")

Batch-convert a directory

Convert an entire directory of structures in parallel, with progress reporting. Files that fail to parse are skipped and listed in the summary; already-converted outputs are skipped by default.

proteintensor convert-dir ./pdb_files/ ./ptt_files/            # auto worker count
proteintensor convert-dir ./pdb_files/ ./ptt_files/ --workers 16 --recursive
proteintensor convert-dir ./pdb_files/ ./ptt_files/ --overwrite  # rebuild existing

Benchmark against mmCIF

proteintensor benchmark 1abc.cif --rounds 20

Load a .ptt

import proteintensor as pt

data = pt.read("1abc.ptt")
data.backbone_positions.shape   # (N_res, 4, 3)  float32
bb  = pt.read_backbone("1abc.ptt")               # fastest structural load
msa = pt.read_msa("1abc.ptt", source="uniref90") # cached MSA, zero-parse

See the full Python API for MSA/embedding caching, sparse pair features, ligands, cloud streaming, and the multi-structure DataLoader.

Run Boltz2 directly from a .ptt file

from proteintensor import BoltzAdapter

adapter = BoltzAdapter("1abc.ptt")
predictions = adapter.predict(
    "boltz_output/",
    model="boltz2",
    diffusion_samples=5,
    recycling_steps=3,
    accelerator="gpu",
)
# -> boltz_output/predictions/1abc/1abc_model_0.cif  (predicted structure)
# -> boltz_output/predictions/1abc/pae_*.npz          (PAE matrix)
# -> boltz_output/predictions/1abc/plddt_*.npz        (per-residue confidence)

Python API

The full Python API - reading, lazy/zero-copy access, dense and sparse pair features, MSA and embedding caching, ligands, cloud streaming, model adapters, and the multi-structure DataLoader - is in docs/API.md.


.ptt file layout

structure.ptt/                      Zarr directory store (v0.7)
├── .zattrs                         format, version, pdb_id, resolution, ...
├── sequence/
│   ├── tokens             [N_res]           int32    0-20=amino acid, 21-29=nucleotide
│   ├── residue_index      [N_res]           int32    PDB sequence numbers
│   ├── chain_id           [N_res]           S1       chain labels
│   └── molecule_type      [N_res]           uint8    0=protein 1=DNA 2=RNA (only if nucleic)
├── atoms/
│   ├── positions          [N_atoms, 3]      float32  Angstrom coordinates
│   ├── mask               [N_atoms]         bool
│   └── b_factors          [N_atoms]         float32  B-factor / pLDDT
├── structure/
│   ├── residue_atom_start [N_res]           int32    first atom index per residue
│   └── residue_atom_count [N_res]           int32    atom count per residue
├── backbone/
│   ├── positions          [N_res, 4, 3]     float32  N/CA/C/O coords
│   └── mask               [N_res, 4]        bool     False = missing atom
├── bonds/
│   ├── edge_index         [2, N_edges]      int32    bidirectional (src, dst)
│   └── edge_type          [N_edges]         uint8    1=SINGLE 2=DOUBLE 4=AROMATIC
│                                                      5=PEPTIDE 6=DISULFIDE
├── msa/
│   └── <source>/                            one sub-group per database source
│       ├── .zattrs                          tool, version, database, date, seq SHA-256
│       ├── tokens         [N_seq, N_res]    int32    0-20=AA 21=GAP 22=MASK
│       ├── deletion_matrix [N_seq, N_res]   float32  insertions before each column
│       ├── profile        [N_res, 23]       float32  per-position residue frequencies
│       └── deletion_mean  [N_res]           float32
├── pairs/
│   └── <name>/                              one sub-group per named feature
│       ├── .zattrs                          channels, symmetric, dtype, description
│       └── data           [N_res, N_res, C] any dtype, chunked 128x128xC
├── pairs_sparse/
│   └── <name>/                              sparse COO pair feature (radius graph)
│       ├── .zattrs                          n_residues, channels, nnz, mode, cutoff, symmetric
│       ├── indices        [2, nnz]          int32    kept (row, col) pairs
│       └── values         [nnz, C]          any dtype  value per kept pair
├── embeddings/
│   └── <model>/                             one sub-group per PLM model
│       ├── .zattrs                          model, layer, dim, dtype, seq SHA-256
│       └── data           [N_res, D]        float32 or float16, chunked 256xD
├── ligands/
│   └── <index>/                            one sub-group per non-polymer ligand
│       ├── .zattrs                          name (CCD), chain_id, res_num, smiles, has_bonds
│       ├── elements           [N_atoms]     S2       element symbols
│       ├── positions          [N_atoms, 3]  float32  Angstrom coordinates
│       ├── b_factors          [N_atoms]     float32
│       ├── bond_index         [2, N_bonds]  int32    exact bond graph (from_smiles / RDKit)
│       ├── bond_order         [N_bonds]     uint8    1=SINGLE 2=DOUBLE 3=TRIPLE 4=AROMATIC
│       ├── formal_charge      [N_atoms]     int8
│       ├── is_aromatic        [N_atoms]     bool
│       ├── interaction_edges  [2, N_int]    int32    (ligand_atom, residue) contacts
│       └── interaction_dist   [N_int]       float32  contact distance (Angstroms)
└── pocket/
    └── binding_site           [N_res]       bool     residues within cutoff of any ligand

Multi-structure dataset layout

dataset.ptt/                        Zarr directory store
├── .zattrs                         format="proteintensor-dataset", version, num_structures
└── structures/
    ├── 000000/                     zero-padded integer key
    │   └── (same layout as single .ptt above)
    ├── 000001/
    │   └── ...
    └── ...

Each sub-group under structures/ is identical to a standalone .ptt root, so all single-structure reader helpers work on sliced groups.


Model adapters

Boltz runs end-to-end from a .ptt. The OpenFold, Chai-1, AlphaFold 3, and Nesso adapters convert a .ptt into each model's native input files (write_input) - validated against each format, with any cached MSA embedded so the model can skip regeneration. Those models are not bundled, so end-to-end prediction through them is not verified here.

Model Native input (per run) .ptt adapter
Boltz-2 / Boltz-1 FASTA + optional A3M MSA BoltzAdapter - verified end-to-end on RTX 5080
OpenFold FASTA + A3M MSA; trains on mmCIF OpenFoldAdapter.write_input - input generation
Chai-1 FASTA + optional MSA / templates / restraints ChaiAdapter.write_input - input generation
AlphaFold 3 JSON (sequences, ligands) + generated MSA AlphaFold3Adapter.write_input - input generation
Nesso-1 (binding affinity) YAML (protein sequences + ligand SMILES) + affinity target NessoAdapter.write_input - input generation
from proteintensor import AlphaFold3Adapter, ChaiAdapter, OpenFoldAdapter, NessoAdapter

AlphaFold3Adapter("1abc.ptt").write_input("af3/1abc.json")   # AF3 fold_input JSON
ChaiAdapter("1abc.ptt").write_input("chai/")                 # Chai FASTA (+ A3M)
OpenFoldAdapter("1abc.ptt").write_input("openfold/")         # FASTA + alignments/
NessoAdapter("6oim.ptt").write_input("nesso/6oim.yaml")      # Nesso YAML (+ affinity)

Ligands need a SMILES string to appear in the Chai / AF3 / Nesso inputs. Ligands added via pt.from_smiles already carry one; ligands extracted from a structure (CCD codes) store elements + coordinates only, so call pt.resolve_ligand_smiles once to backfill canonical SMILES from the RCSB Chemical Component Dictionary (fetched and cached, never guessed):

pt.resolve_ligand_smiles("6oim.ptt")            # MG, GDP, MOV (sotorasib) -> SMILES
NessoAdapter("6oim.ptt").write_input("nesso/6oim.yaml")   # now includes the ligands

Every one of these re-derives the same features before each run - parse the structure (mmCIF / PDB), tokenize the sequence (FASTA), and generate or parse the MSA. ProteinTensor replaces that recurring work with a single zero-parse read:

Input path Structure Sequence + MSA Cost per run
Native (mmCIF/PDB + FASTA + MSA files) parse mmCIF/PDB text parse FASTA + generate/parse MSA re-parsed and re-featurized every epoch
ProteinTensor (.ptt) zero-parse read zero-parse read (lazy, partial) converted once, then loaded

Run tests

pytest tests/ -v

190 tests across structure roundtrip, nucleic-acid (DNA/RNA) support, backbone/bonds/ MSA/pairs (dense + sparse)/embeddings/ligands (bond graphs, pockets, binding sites), sequence conversion, A3M parsing, model input adapters (Boltz, AlphaFold 3, Chai-1, OpenFold, Nesso), multi-structure dataset, and cloud streaming (memory:// fsspec - no real cloud account required).

About

AI-native tensor format (.ptt) for structural biology ML. Convert a protein/nucleic-acid/ligand structure or sequence once; load backbone, MSA, ESM embeddings, sparse pair features, and ligand pockets with zero parsing. Feeds Boltz-2 (verified), AlphaFold 3, Chai-1, Nesso. Zarr-backed, PyTorch/JAX, streams from S3/GCS.

Topics

Resources

Code of conduct

Contributing

Security policy

Stars

Watchers

Forks

Releases

Packages

Contributors

Languages